McDonnell Genome Institute

Washington University

Transcript

lnc-RPE-7:1

Chromosome

chr2

Gene Name

lnc-RPE-7

Start

210088225

CPC Label

noncoding

End

210089064

Cancer

HCC

Strand

+

Peptide

AEILSIVRR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

52

Open Reading Frame (ORF)

MAGEKVEKPDTKEKKPEGKKADTSGKVKRGNFKAKNPKAEILSIVRRIGRYA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0933833

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9484

PhyloCSF Frame 3

0

CNTI Score

-0.338601663