McDonnell Genome Institute

Washington University

Transcript

lnc-RPAP1-2:1

Chromosome

chr15

Gene Name

lnc-RPAP1-2

Start

41574160

CPC Label

noncoding

End

41574633

Cancer

BRCA-Luminal A

Strand

-

Peptide

GGSSLLPR

Modified Peptide

n[145]GGSSLLPR

Peptide Length

8

ORF Length

58

Open Reading Frame (ORF)

LPSPEGFGLAERRGGSSLLPRISVLYLRFPRELSLGSFLRLAGVSRTKVVFTRVEQIK

Conservation Score

0.981

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0527143

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.452203082