McDonnell Genome Institute

Washington University

Transcript

lnc-RPA3-2:3

Chromosome

chr7

Gene Name

lnc-RPA3-2

Start

7738638

CPC Label

noncoding

End

7741120

Cancer

OV

Strand

-

Peptide

LSSILVSTCQDINR

Modified Peptide

n[145]LSSILVSTCQDINR

Peptide Length

14

ORF Length

57

Open Reading Frame (ORF)

LQLIKQIWVKREKEKGRNKEKPVFKLSSILVSTCQDINRCWIRSKETKVITKSLIAV

Conservation Score

0.854

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0693913

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8184

PhyloCSF Frame 3

0

CNTI Score

-0.391670946