McDonnell Genome Institute

Washington University

Transcript

lnc-RPA3-2:1

Chromosome

chr7

Gene Name

lnc-RPA3-2

Start

7738533

CPC Label

noncoding

End

7742573

Cancer

EOGC

Strand

-

Peptide

LNHYTIKFPLTTESAMK

Modified Peptide

n[145]LNHYTIKFPLTTESAMK

Peptide Length

17

ORF Length

74

Open Reading Frame (ORF)

LRLRRQPRYPRKSAPRRNKLNHYTIKFPLTTESAMKKTEDNSTLVFTVDVKANKHQIKQAVKKLCDIDVAKVNT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.189

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6263

PhyloCSF Frame 3

0

CNTI Score

0.687288724