McDonnell Genome Institute

Washington University

Transcript

lnc-RORA-5:2

Chromosome

chr15

Gene Name

lnc-RORA-5

Start

60445502

CPC Label

noncoding

End

60447551

Cancer

BRCA-Basal-like

Strand

-

Peptide

VLCLDLSPVPK

Modified Peptide

n[145]VLCLDLSPVPK

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

MYMVDMKHKRVLCLDLSPVPKISHYVYVNIRKSRKKSKI

Conservation Score

0.144

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0113723

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.365361825