McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1L-2:2

Chromosome

chr5

Gene Name

lnc-ROPN1L-2

Start

10435769

CPC Label

noncoding

End

10437849

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LTISLALIRHK

Modified Peptide

n[145]LTISLALIRHK

Peptide Length

11

ORF Length

35

Open Reading Frame (ORF)

LTISLALIRHKDKTVYVCFHSCFVRVPHFVVMKVT

Conservation Score

1

PhyloCSF Frame 1

-4.395

No. of Spectra

1

CPC Coding Probability

0.163112

PhyloCSF Frame 2 

-3.743

CNTI Index

noncoding

Max Probability

0.8247

PhyloCSF Frame 3

-4.608

CNTI Score

-0.373479518