McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1L-14:1

Chromosome

chr5

Gene Name

lnc-ROPN1L-14

Start

10594825

CPC Label

noncoding

End

10596210

Cancer

OV

Strand

+

Peptide

DLDTLKR

Modified Peptide

n[145]DLDTLKR

Peptide Length

7

ORF Length

88

Open Reading Frame (ORF)

LGFHSPGDWWDPAGPNPPVGPDGQRRDLDTLKRRNESSEVQPLLAMSSSGLIPALQPWTFSLVFSSGHHLDDYDSGNLCPSSIFLPPL

Conservation Score

0.694

PhyloCSF Frame 1

-3.487

No. of Spectra

9

CPC Coding Probability

0.0956636

PhyloCSF Frame 2 

-4.422

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

-4.36

CNTI Score

-0.429669292