McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1L-13:1

Chromosome

chr5

Gene Name

lnc-ROPN1L-13

Start

10619291

CPC Label

noncoding

End

10620629

Cancer

OV

Strand

+

Peptide

AMEESWGSR

Modified Peptide

n[145]AM[147]EESWGSR

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

LAVVVMRAMEESWGSRMALGFGTGDNTNCKGHISKRR

Conservation Score

0.013

PhyloCSF Frame 1

-4.03

No. of Spectra

10

CPC Coding Probability

0.0181018

PhyloCSF Frame 2 

-5.079

CNTI Index

noncoding

Max Probability

0.835

PhyloCSF Frame 3

-4.282

CNTI Score

-0.370648826