McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1B-2:8

Chromosome

chr3

Gene Name

lnc-ROPN1B-2

Start

126084214

CPC Label

noncoding

End

126095349

Cancer

OV

Strand

+

Peptide

VESAAGLESPR

Modified Peptide

n[145]VESAAGLESPR

Peptide Length

11

ORF Length

106

Open Reading Frame (ORF)

LALRDSSRRPSSGSAEPRRGPGGLGAGDRGDGSGGPSLASPGPPRSWGPTGAPAGALRERRLCGCRFYYGAVKVESAAGLESPRLSWSRQVASIVGAQIQVEGLPE

Conservation Score

0.111

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.0209449

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9942

PhyloCSF Frame 3

0

CNTI Score

-0.322507713