McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1B-15:1

Chromosome

chr3

Gene Name

lnc-ROPN1B-15

Start

125990427

CPC Label

noncoding

End

126003613

Cancer

LUAD

Strand

+

Peptide

LSFINVEEIK

Modified Peptide

n[230]LSFINVEEIK

Peptide Length

10

ORF Length

77

Open Reading Frame (ORF)

LQEPYKPEESGGQCSTFLKNFQPRISYPAKLSFINVEEIKFFTDKQMLRDFVTTRPALQELLKGALNMVRNNRYQSL

Conservation Score

0.475

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.169312

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8283

PhyloCSF Frame 3

0

CNTI Score

0.650391093