McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1B-13:4

Chromosome

chr3

Gene Name

lnc-ROPN1B-13

Start

125595671

CPC Label

coding

End

125619389

Cancer

OV

Strand

+

Peptide

TAEVCLHCNR

Modified Peptide

n[145]TAEVCLHCNR

Peptide Length

10

ORF Length

70

Open Reading Frame (ORF)

LVAGRLYWTSSIMERTAEVCLHCNRYLLWIWVCLSCMQCFCQDCHPWTHGMPYPPSWYSSTALPLTKALT

Conservation Score

0.675

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.845041

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9896

PhyloCSF Frame 3

0

CNTI Score

-0.345125499