McDonnell Genome Institute

Washington University

Transcript

lnc-ROPN1B-13:2

Chromosome

chr3

Gene Name

lnc-ROPN1B-13

Start

125595671

CPC Label

noncoding

End

125602953

Cancer

CCRC

Strand

+

Peptide

VVAVGIER

Modified Peptide

n[230]VVAVGIER

Peptide Length

8

ORF Length

50

Open Reading Frame (ORF)

MRAEIIAAWTRVVAVGIERSKWIQAVSGMGLQYCKWTGFAIVKLPLQNYN

Conservation Score

0.085

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0935717

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

-0.348133112