McDonnell Genome Institute

Washington University

Transcript

lnc-ROCK2-3:12

Chromosome

chr2

Gene Name

lnc-ROCK2-3

Start

11128113

CPC Label

noncoding

End

11131816

Cancer

LUAD

Strand

-

Peptide

VLLQASHK

Modified Peptide

n[230]VLLQASHK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LSGTLTRDLAPRVLLQASHKGPLCLACTKILDSQYEDINHSVYTV

Conservation Score

0.064

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.176717

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.376958164