McDonnell Genome Institute

Washington University

Transcript

lnc-ROBO3-2:1

Chromosome

chr11

Gene Name

lnc-ROBO3-2

Start

124800449

CPC Label

noncoding

End

124834487

Cancer

OV

Strand

+

Peptide

LEGGAESPSPLIMAGPPFTSLAYK

Modified Peptide

n[145]LEGGAESPSPLIMAGPPFTSLAYK

Peptide Length

24

ORF Length

46

Open Reading Frame (ORF)

LTTGDQPKLQILSLPQRLEGGAESPSPLIMAGPPFTSLAYKRLLLL

Conservation Score

0.079

PhyloCSF Frame 1

-4.127

No. of Spectra

16

CPC Coding Probability

0.0430834

PhyloCSF Frame 2 

-4.133

CNTI Index

noncoding

Max Probability

0.9337

PhyloCSF Frame 3

-5.563

CNTI Score

-0.351609162