McDonnell Genome Institute

Washington University

Transcript

lnc-ROBO2-9:1

Chromosome

chr3

Gene Name

lnc-ROBO2-9

Start

78525100

CPC Label

noncoding

End

78525485

Cancer

EOGC

Strand

+

Peptide

NYQPGEFSQFGNYPAK

Modified Peptide

n[145]NYQPGEFSQFGNYPAK

Peptide Length

16

ORF Length

55

Open Reading Frame (ORF)

MNSVKHELAEIIFIFGKVIDPVTGKLCKNYQPGEFSQFGNYPAKQKSRSTQNLFN

Conservation Score

1

PhyloCSF Frame 1

-5.366

No. of Spectra

1

CPC Coding Probability

0.119692

PhyloCSF Frame 2 

-4.426

CNTI Index

noncoding

Max Probability

0.6982

PhyloCSF Frame 3

-4.909

CNTI Score

-0.394819707