McDonnell Genome Institute

Washington University

Transcript

lnc-ROBO2-10:1

Chromosome

chr3

Gene Name

lnc-ROBO2-10

Start

78758973

CPC Label

noncoding

End

78759374

Cancer

OV

Strand

+

Peptide

CWRAPSSMR

Modified Peptide

n[145]CWRAPSSM[147]R

Peptide Length

9

ORF Length

67

Open Reading Frame (ORF)

LLCKRCWRAPSSMRAWRVGFVVAPKSETRAKPIFVLLQANVMSLYVCQIGEGSCDEHQINLLRLMTT

Conservation Score

1

PhyloCSF Frame 1

-5.105

No. of Spectra

1

CPC Coding Probability

0.0435847

PhyloCSF Frame 2 

-5.673

CNTI Index

noncoding

Max Probability

0.0502

PhyloCSF Frame 3

-4.368

CNTI Score

-0.373094016