McDonnell Genome Institute

Washington University

Transcript

lnc-RNMT-5:1

Chromosome

chr18

Gene Name

lnc-RNMT-5

Start

13486461

CPC Label

noncoding

End

13490676

Cancer

OV

Strand

+

Peptide

GERPSVLAQTGVELIQGPGR

Modified Peptide

n[145]GERPSVLAQTGVELIQGPGR

Peptide Length

20

ORF Length

103

Open Reading Frame (ORF)

LSLLLCKTHPAHARSRGAHTPRCPSCQQVHSWRNRLPRPDSPERGERPSVLAQTGVELIQGPGRSLNTSGTLTLASIQALDTVVRRISRMSQKTVKVQRFIAE

Conservation Score

0.099

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.268359

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7315

PhyloCSF Frame 3

0

CNTI Score

-0.323208804