McDonnell Genome Institute

Washington University

Transcript

lnc-RNMT-4:1

Chromosome

chr18

Gene Name

lnc-RNMT-4

Start

13514519

CPC Label

noncoding

End

13522888

Cancer

BRCA-Luminal B

Strand

+

Peptide

LNMQCPGLLSAGGLR

Modified Peptide

n[145]LNM[147]QCPGLLSAGGLR

Peptide Length

15

ORF Length

50

Open Reading Frame (ORF)

LNMQCPGLLSAGGLRTLVLTLQGYGEVIHVKLLVNKCYLLNMFVFIIFFP

Conservation Score

0.252

PhyloCSF Frame 1

-4.922

No. of Spectra

1

CPC Coding Probability

0.140758

PhyloCSF Frame 2 

-5.176

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-1.967

CNTI Score

-0.32954193