McDonnell Genome Institute

Washington University

Transcript

lnc-RNLS-2:1

Chromosome

chr10

Gene Name

lnc-RNLS-2

Start

88618222

CPC Label

coding

End

88618934

Cancer

CCRC

Strand

-

Peptide

QMPITEIQMAR

Modified Peptide

n[230]QM[147]PITEIQMAR

Peptide Length

11

ORF Length

90

Open Reading Frame (ORF)

LKIKMPKKENMLQKARRKLIYEKAKHYHKDYRQMPITEIQMARLAKKAGNCYILAEPKLAFVIRVRGINGVSPKGVATLLPLPDFQQKLC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.515834

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7576

PhyloCSF Frame 3

0

CNTI Score

0.601783212