McDonnell Genome Institute

Washington University

Transcript

lnc-RNFT2-1:5

Chromosome

chr12

Gene Name

lnc-RNFT2-1

Start

116661543

CPC Label

coding

End

116664322

Cancer

BRCA-Basal-like

Strand

+

Peptide

QQALPLWYLGSCVCESLALSQVPCFK

Modified Peptide

n[145]QQALPLWYLGSCVCESLALSQVPCFK

Peptide Length

26

ORF Length

73

Open Reading Frame (ORF)

LRLLPSTQTSCPSFLLPLFRQGYSDGRAGCGQRSGSSPACPGTRQQALPLWYLGSCVCESLALSQVPCFKKIQ

Conservation Score

0.966

PhyloCSF Frame 1

-3.585

No. of Spectra

5

CPC Coding Probability

0.694945

PhyloCSF Frame 2 

-2.067

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-4.062

CNTI Score

-0.310362539