McDonnell Genome Institute

Washington University

Transcript

lnc-RNF7-2:1

Chromosome

chr3

Gene Name

lnc-RNF7-2

Start

141663198

CPC Label

coding

End

141721073

Cancer

EOGC

Strand

+

Peptide

EICIWGLQLSNPEIAR

Modified Peptide

n[145]EICIWGLQLSNPEIAR

Peptide Length

16

ORF Length

261

Open Reading Frame (ORF)

LKSSIDSDQVLRKFMLVRPNDSPPRILPVSLEPLLMTIQDEHYTLAKEICIWGLQLSNPEIARLALLLELKGHTTCPFTTLEIIDCKMDLWSLERLGKALRFSSLHSLVLDYCKFGNEELESIFSGLENNQRLQGLSLRYCGLGPQSGLRLGSVISQSAICELFLDGNYLECSGALALLRPIAGFAETQGEDQPAPGSPDTGNPPQRLQAKQRGSSTMNQITKSSEAVTVKTTSGKKKRKKGIKKKIEGLMESGPWLVKLH

Conservation Score

1

PhyloCSF Frame 1

9.64

No. of Spectra

2

CPC Coding Probability

0.999833

PhyloCSF Frame 2 

9.754

CNTI Index

coding

Max Probability

0.6107

PhyloCSF Frame 3

7.366

CNTI Score

0.700961021