McDonnell Genome Institute

Washington University

Transcript

lnc-RNF6-5:1

Chromosome

chr13

Gene Name

lnc-RNF6-5

Start

26327810

CPC Label

noncoding

End

26329920

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

AVHYFFHGK

Modified Peptide

n[145]AVHYFFHGK

Peptide Length

9

ORF Length

88

Open Reading Frame (ORF)

LQARSSRLALHCIKLLYTDYIVNRCGLGFKLCGLGFRSLFWRIKFSVAKIGKYSGTVNQIKELAPDCKAVHYFFHGKRHALRKTKQLK

Conservation Score

0.788

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0273571

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

0

CNTI Score

-0.351083