McDonnell Genome Institute

Washington University

Transcript

lnc-RNF6-4:4

Chromosome

chr13

Gene Name

lnc-RNF6-4

Start

26114408

CPC Label

noncoding

End

26154175

Cancer

OV

Strand

-

Peptide

LMCYIATANLDRETDLK

Modified Peptide

n[145]LMCYIATANLDRETDLK

Peptide Length

17

ORF Length

89

Open Reading Frame (ORF)

LMCYIATANLDRETDLKIWLCQIQAEVLPENQLLSLSGKIDCEAPHLHFNSFAGTWSLRGKIPVPIGPDQVLFRGTQLGNTQWIIGVAV

Conservation Score

1

PhyloCSF Frame 1

-2.206

No. of Spectra

2

CPC Coding Probability

0.179315

PhyloCSF Frame 2 

2.427

CNTI Index

noncoding

Max Probability

0.6353

PhyloCSF Frame 3

-4.09

CNTI Score

-0.376573435