McDonnell Genome Institute

Washington University

Transcript

lnc-RNF4-4:1

Chromosome

chr4

Gene Name

lnc-RNF4-4

Start

2432827

CPC Label

noncoding

End

2435265

Cancer

PRAD

Strand

+

Peptide

ASPPQDPLPAAQWGSPHPPSPLSMPSLTHR

Modified Peptide

Peptide Length

30

ORF Length

109

Open Reading Frame (ORF)

LAVEIRASPPQDPLPAAQWGSPHPPSPLSMPSLTHRMSLGPRDLCGGRAFPFLSGERPGGHLAKKGTVNKPCRDWDRPCPARAGQKHSPHSRGASMPGGVLRQREKPVP

Conservation Score

0.896

PhyloCSF Frame 1

-3.828

No. of Spectra

16

CPC Coding Probability

0.153809

PhyloCSF Frame 2 

-4.08

CNTI Index

noncoding

Max Probability

0.975

PhyloCSF Frame 3

-2.497

CNTI Score

-0.311240462