McDonnell Genome Institute

Washington University

Transcript

lnc-RNF39-4:20

Chromosome

chr6

Gene Name

lnc-RNF39-4

Start

29988242

CPC Label

noncoding

End

30067036

Cancer

CCRC

Strand

-

Peptide

RVEAQNPGPR

Modified Peptide

n[230]RVEAQNPGPR

Peptide Length

10

ORF Length

164

Open Reading Frame (ORF)

LLSLRDMAAPISLLTPSQDEGLGQPLVLHMACVSLFLSRRHYHNRPLLEGSIPCGPGLHELHVLGLVLPIPLPGQCDLRRVEAQNPGPRYASCSERGVGHVCLGGGLKGRVGKLRHFAFLMGHPSSAHVTILMNRTPGVGKGAQSPDTSLDTGAWDNLLFLGKF

Conservation Score

1

PhyloCSF Frame 1

-2.725

No. of Spectra

6

CPC Coding Probability

0.462131

PhyloCSF Frame 2 

7.203

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-2.214

CNTI Score

-0.287567535