McDonnell Genome Institute

Washington University

Transcript

lnc-RNF39-13:1

Chromosome

chr6

Gene Name

lnc-RNF39-13

Start

29899390

CPC Label

noncoding

End

29943436

Cancer

OV

Strand

-

Peptide

HTLQPQMANNAEGHVLLR

Modified Peptide

n[145]HTLQPQMANNAEGHVLLR

Peptide Length

18

ORF Length

64

Open Reading Frame (ORF)

MSMLQGLYKNQKRRDCTNLDCRVTLLYTRKHTLQPQMANNAEGHVLLRGKFDRKLKWSIETLFV

Conservation Score

0.015

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0680689

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0665

PhyloCSF Frame 3

0

CNTI Score

-0.312783601