McDonnell Genome Institute

Washington University

Transcript

lnc-RNF34-1:1

Chromosome

chr12

Gene Name

lnc-RNF34-1

Start

121375392

CPC Label

noncoding

End

121392412

Cancer

OV

Strand

+

Peptide

QGWLESLFDLLNYKTYAMSPK

Modified Peptide

n[145]QGWLESLFDLLNYKTYAM[147]SPK

Peptide Length

21

ORF Length

41

Open Reading Frame (ORF)

MTYLQLWHLQTQVKQGWLESLFDLLNYKTYAMSPKKMDYLE

Conservation Score

0.916

PhyloCSF Frame 1

-5.092

No. of Spectra

1

CPC Coding Probability

0.013245

PhyloCSF Frame 2 

-3.482

CNTI Index

noncoding

Max Probability

0.5506

PhyloCSF Frame 3

-6.533

CNTI Score

-0.356183118