McDonnell Genome Institute

Washington University

Transcript

lnc-RNF32-5:4

Chromosome

chr7

Gene Name

lnc-RNF32-5

Start

156263546

CPC Label

noncoding

End

156263802

Cancer

OV

Strand

+

Peptide

GLSEDRK

Modified Peptide

n[145]GLSEDRK

Peptide Length

7

ORF Length

53

Open Reading Frame (ORF)

LGGDKATDFVMTWGSWDYAKKNEFRHRLSTRGLSEDRKISKKQQRECKGRVRK

Conservation Score

1

PhyloCSF Frame 1

-4.174

No. of Spectra

1

CPC Coding Probability

0.0250007

PhyloCSF Frame 2 

-4.711

CNTI Index

noncoding

Max Probability

0.7483

PhyloCSF Frame 3

-4.097

CNTI Score

-0.40934775