McDonnell Genome Institute

Washington University

Transcript

lnc-RNF24-3:1

Chromosome

chr20

Gene Name

lnc-RNF24-3

Start

4023734

CPC Label

coding

End

4024603

Cancer

EOGC

Strand

-

Peptide

SEAGRPSPDLFRPNTVEAR

Modified Peptide

n[145]SEAGRPSPDLFRPNTVEAR

Peptide Length

19

ORF Length

61

Open Reading Frame (ORF)

MVGRQEGANDKNGAGRSQKQEIAEKMVPEVASGEEIGGRSEAGRPSPDLFRPNTVEARDRP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.774853

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8739

PhyloCSF Frame 3

0

CNTI Score

-0.303522264