McDonnell Genome Institute

Washington University

Transcript

lnc-RNF24-2:8

Chromosome

chr20

Gene Name

lnc-RNF24-2

Start

3868559

CPC Label

noncoding

End

3889173

Cancer

OSCC

Strand

-

Peptide

SLNPFYMPYPGYLPSWLVTVLK

Modified Peptide

n[145]SLNPFYM[147]PYPGYLPSWLVTVLK

Peptide Length

22

ORF Length

33

Open Reading Frame (ORF)

MGGGARGLGRSLNPFYMPYPGYLPSWLVTVLKL

Conservation Score

0.107

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.237469

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7472

PhyloCSF Frame 3

0

CNTI Score

-0.282687035