McDonnell Genome Institute

Washington University

Transcript

lnc-RNF215-1:2

Chromosome

chr22

Gene Name

lnc-RNF215-1

Start

30368810

CPC Label

noncoding

End

30377905

Cancer

OV

Strand

-

Peptide

FSDTDVNK

Modified Peptide

n[145]FSDTDVNK

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

MFSDTDVNKRELSPSVTLTQLTTARSPLCGPHPKLQA

Conservation Score

0.041

PhyloCSF Frame 1

-5.881

No. of Spectra

23

CPC Coding Probability

0.290596

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

0.748201861