McDonnell Genome Institute

Washington University

Transcript

lnc-RNF208-1:1

Chromosome

chr9

Gene Name

lnc-RNF208-1

Start

137224114

CPC Label

noncoding

End

137227813

Cancer

PRAD

Strand

-

Peptide

LSCVASSAATSSPCLCPAR

Modified Peptide

LSCVASSAATSSPCLCPAR

Peptide Length

19

ORF Length

252

Open Reading Frame (ORF)

LAQGQGSDPSVPRLETSACHAPALPCCGAGHHASGKGWHGVRTRLSCVASSAATSSPCLCPARNTRAPQAGLNAHSLPGILAYSGEAVPAQSSLAPGAQPQRGPHPAQQTRRRPSTHGPSLLLPHPQGLVQATSSRKPRPRGRTGGVQELDISWETRKTSQLRLGGESPVGRAWSWLSGLSCPNLPLPETCSTCCTHHPLVDTLLLLEAFPGVPPVPCAVSSCCPTHGLTPAHSLSLGPRERRSAQIQTWLS

Conservation Score

1

PhyloCSF Frame 1

-0.091

No. of Spectra

1

CPC Coding Probability

0.14498

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8001

PhyloCSF Frame 3

0

CNTI Score

-0.262679081