McDonnell Genome Institute

Washington University

Transcript

lnc-RNF207-4:1

Chromosome

chr1

Gene Name

lnc-RNF207-4

Start

5992672

CPC Label

noncoding

End

6007660

Cancer

OV

Strand

+

Peptide

EAEAAAWSQSRRQSGSIR

Modified Peptide

n[145]EAEAAAWSQSRRQSGSIR

Peptide Length

18

ORF Length

47

Open Reading Frame (ORF)

MFRPLLVYLREAEAAAWSQSRRQSGSIRGEPRHLCASSAPPLRPAPC

Conservation Score

0.996

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.151706

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9925

PhyloCSF Frame 3

0

CNTI Score

-0.300906006