McDonnell Genome Institute

Washington University

Transcript

lnc-RNF207-3:1

Chromosome

chr1

Gene Name

lnc-RNF207-3

Start

6160397

CPC Label

coding

End

6162017

Cancer

LUAD

Strand

+

Peptide

DTLSLSPHPSK

Modified Peptide

n[230]DTLSLSPHPSK

Peptide Length

11

ORF Length

54

Open Reading Frame (ORF)

LRDTLSLSPHPSKGKDKRGRHELQHHGQRLGLAGGRGPGWPSAAREQTPQTYRG

Conservation Score

1

PhyloCSF Frame 1

-4.084

No. of Spectra

1

CPC Coding Probability

0.535239

PhyloCSF Frame 2 

-2.347

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-3.144

CNTI Score

-0.329399342