McDonnell Genome Institute

Washington University

Transcript

lnc-RNF19B-1:7

Chromosome

chr1

Gene Name

lnc-RNF19B-1

Start

33010518

CPC Label

noncoding

End

33012357

Cancer

PRAD

Strand

-

Peptide

LGEDIVIK

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

42

Open Reading Frame (ORF)

LGEDIVIKRARPNWNIFVICIMMLKIAIIWELGLKTELLPEN

Conservation Score

0.956

PhyloCSF Frame 1

-5.18

No. of Spectra

3

CPC Coding Probability

0.00685646

PhyloCSF Frame 2 

-4.339

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-4.867

CNTI Score

-0.387591882