McDonnell Genome Institute

Washington University

Transcript

lnc-RNF19A-8:2

Chromosome

chr8

Gene Name

lnc-RNF19A-8

Start

100300577

CPC Label

noncoding

End

100310148

Cancer

OSCC

Strand

-

Peptide

RLGASEGPSPALPQAAVAAAGR

Modified Peptide

n[145]RLGASEGPSPALPQAAVAAAGR

Peptide Length

22

ORF Length

102

Open Reading Frame (ORF)

LRRWFPGAAVEPQLRRRSSGKRPSGLLPSVVSAPVERRLGASEGPSPALPQAAVAAAGRWAYSPATLRCRRSEELKGQVDPLQRRRRAEKEEAVCSWRRRLE

Conservation Score

1

PhyloCSF Frame 1

-2.957

No. of Spectra

5

CPC Coding Probability

0.0182633

PhyloCSF Frame 2 

2.192

CNTI Index

noncoding

Max Probability

0.1116

PhyloCSF Frame 3

1.26

CNTI Score

-0.335035703