McDonnell Genome Institute

Washington University

Transcript

lnc-RNF186-1:1

Chromosome

chr1

Gene Name

lnc-RNF186-1

Start

19684090

CPC Label

noncoding

End

19690135

Cancer

PRAD

Strand

-

Peptide

HLAASCHHQQGSELMPPDPCPGVSLCQK

Modified Peptide

HLAASCHHQQGSELMPPDPCPGVSLCQK

Peptide Length

28

ORF Length

34

Open Reading Frame (ORF)

LPRHLAASCHHQQGSELMPPDPCPGVSLCQKNQR

Conservation Score

0.803

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.101284

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9655

PhyloCSF Frame 3

0

CNTI Score

-0.315399839