McDonnell Genome Institute

Washington University

Transcript

lnc-RNF170-7:1

Chromosome

chr8

Gene Name

lnc-RNF170-7

Start

43276269

CPC Label

noncoding

End

43276823

Cancer

EOGC

Strand

-

Peptide

LGTAGQEPVGVILLRPLLLFPSAESSR

Modified Peptide

n[145]LGTAGQEPVGVILLRPLLLFPSAESSR

Peptide Length

27

ORF Length

103

Open Reading Frame (ORF)

LGTAGQEPVGVILLRPLLLFPSAESSRKNSSGLKHLHEFFNIPFLQLQREKKQLEVDSTLEERWCSRRLRTRSIALSSTWGLPAAAPRPRWRPTGKAGPWPPR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.162205

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.108

PhyloCSF Frame 3

0

CNTI Score

-0.309067584