McDonnell Genome Institute

Washington University

Transcript

lnc-RNF17-1:1

Chromosome

chr13

Gene Name

lnc-RNF17-1

Start

24747684

CPC Label

noncoding

End

24753923

Cancer

OV

Strand

+

Peptide

VEAAGALK

Modified Peptide

n[145]VEAAGALK

Peptide Length

8

ORF Length

65

Open Reading Frame (ORF)

LAAQRSISSQGAQTSGEKVEAAGALKAAPGWLKRFLVRTPRPPCSGPTQPGSGLSYSSFSFLGNC

Conservation Score

0.095

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0386673

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9847

PhyloCSF Frame 3

0

CNTI Score

-0.307478186