McDonnell Genome Institute

Washington University

Transcript

lnc-RNF152-2:9

Chromosome

chr18

Gene Name

lnc-RNF152-2

Start

61571347

CPC Label

noncoding

End

61579456

Cancer

CRC

Strand

-

Peptide

LTFFCQVTLQVSCFLDSLQIR

Modified Peptide

LTFFCQVTLQVSCFLDSLQIR

Peptide Length

21

ORF Length

41

Open Reading Frame (ORF)

LTFFCQVTLQVSCFLDSLQIRVPRISQDLQHLMTSHGEEIR

Conservation Score

0.464

PhyloCSF Frame 1

-4.841

No. of Spectra

1

CPC Coding Probability

0.039853

PhyloCSF Frame 2 

-4.433

CNTI Index

noncoding

Max Probability

0.8055

PhyloCSF Frame 3

-5.552

CNTI Score

-0.416506363