McDonnell Genome Institute

Washington University

Transcript

lnc-RNF152-2:8

Chromosome

chr18

Gene Name

lnc-RNF152-2

Start

61585745

CPC Label

noncoding

End

61606657

Cancer

HCC

Strand

-

Peptide

IPQMNWFCPVSLNGFYFLMSSVAAWQR

Modified Peptide

n[230]IPQM[147]NWFCPVSLNGFYFLM[147]SSVAAWQR

Peptide Length

27

ORF Length

116

Open Reading Frame (ORF)

LCVSPLLPCTPDCRQASGEVANSWDPPVKSLLSARDVKRLGLSPIGRRIPQMNWFCPVSLNGFYFLMSSVAAWQRHLVERTRGSGNNQSSLVHILVLSLINRVTLEVICCSLSLRS

Conservation Score

1

PhyloCSF Frame 1

-2.143

No. of Spectra

4

CPC Coding Probability

0.0327025

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3894

PhyloCSF Frame 3

-4.572

CNTI Score

-0.366330769