McDonnell Genome Institute

Washington University

Transcript

lnc-RNF144B-5:1

Chromosome

chr6

Gene Name

lnc-RNF144B-5

Start

19143694

CPC Label

noncoding

End

19144160

Cancer

CCRC

Strand

+

Peptide

KGDIVGIK

Modified Peptide

KGDIVGIK

Peptide Length

8

ORF Length

75

Open Reading Frame (ORF)

MTNTKGRRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVGIKGMHTVEKGMPASVTMAKLEEPTMFPSTLLRCC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.125832

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5595

PhyloCSF Frame 3

0

CNTI Score

-0.336752839