McDonnell Genome Institute

Washington University

Transcript

lnc-RNF144B-3:1

Chromosome

chr6

Gene Name

lnc-RNF144B-3

Start

18630725

CPC Label

noncoding

End

18830877

Cancer

OSCC

Strand

+

Peptide

LMATFPGYDDGFHR

Modified Peptide

n[145]LMATFPGYDDGFHR

Peptide Length

14

ORF Length

45

Open Reading Frame (ORF)

LMATFPGYDDGFHRQLRQYLLISMPFCNVILPLLHLEAECMSPLP

Conservation Score

0.232

PhyloCSF Frame 1

-5.561

No. of Spectra

9

CPC Coding Probability

0.0507115

PhyloCSF Frame 2 

-6.043

CNTI Index

noncoding

Max Probability

0.697

PhyloCSF Frame 3

-5.55

CNTI Score

-0.373753546