McDonnell Genome Institute

Washington University

Transcript

lnc-RNF139-3:1

Chromosome

chr8

Gene Name

lnc-RNF139-3

Start

124459167

CPC Label

noncoding

End

124460570

Cancer

OV

Strand

+

Peptide

GGLWVSDPGDVAAISPSMLR

Modified Peptide

n[145]GGLWVSDPGDVAAISPSMLR

Peptide Length

20

ORF Length

87

Open Reading Frame (ORF)

LENSSTKFPSLSCTDSDHVNQFWQGAAGRGPRGGLWVSDPGDVAAISPSMLRLAEQHCRTDFLRGSLISYTALKCLSLHLSCEKIKK

Conservation Score

0.11

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0212287

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4202

PhyloCSF Frame 3

0

CNTI Score

-0.349039591