McDonnell Genome Institute

Washington University

Transcript

lnc-RNF135-1:35

Chromosome

chr17

Gene Name

lnc-RNF135-1

Start

30576464

CPC Label

coding

End

30687564

Cancer

OV

Strand

+

Peptide

AITDFFK

Modified Peptide

n[145]AITDFFK

Peptide Length

7

ORF Length

120

Open Reading Frame (ORF)

LQTTTNPLPHSHHHACHPILTLLRTPSPTRRRAVSALEDGGCLVCFLHGWIYCPSTPKESLIHSFLGVGIGGWGQTGMTESFSCLKAITDFFKIEKCYRGSNLDPKHLFSLNHPTPAPRL

Conservation Score

0.454

PhyloCSF Frame 1

0

No. of Spectra

31

CPC Coding Probability

0.506078

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9662

PhyloCSF Frame 3

0

CNTI Score

0.730773965