McDonnell Genome Institute

Washington University

Transcript

lnc-RNF135-1:34

Chromosome

chr17

Gene Name

lnc-RNF135-1

Start

30576464

CPC Label

coding

End

30672946

Cancer

LUAD

Strand

+

Peptide

VVIQMYVFQYIVFYCLSK

Modified Peptide

VVIQM[147]YVFQYIVFYCLSK

Peptide Length

18

ORF Length

36

Open Reading Frame (ORF)

MVVIQMYVFQYIVFYCLSKSLPGRINTSQVLLHRVE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.506078

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

0

CNTI Score

-0.258510665