McDonnell Genome Institute

Washington University

Transcript

lnc-RNF135-1:33

Chromosome

chr17

Gene Name

lnc-RNF135-1

Start

30576464

CPC Label

coding

End

30644920

Cancer

CRC

Strand

+

Peptide

LLFSMVSR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LKLLFSMVSRCWLKGSIAQQLSQTVRVQIPSLPCNSCVTLGKLLNLSVPPSIKWGK

Conservation Score

0.998

PhyloCSF Frame 1

-4.978

No. of Spectra

1

CPC Coding Probability

0.850593

PhyloCSF Frame 2 

-3.54

CNTI Index

coding

Max Probability

0.6608

PhyloCSF Frame 3

-4

CNTI Score

0.684708949