McDonnell Genome Institute

Washington University

Transcript

lnc-RNF135-1:27

Chromosome

chr17

Gene Name

lnc-RNF135-1

Start

30632121

CPC Label

coding

End

30637464

Cancer

PRAD

Strand

+

Peptide

TFGVETR

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

LSGWDYRQAVNFKTFGVETRSCYVAQAGFPATLEQVSFFSYF

Conservation Score

0.127

PhyloCSF Frame 1

0

No. of Spectra

29

CPC Coding Probability

0.918261

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

0.704405525