McDonnell Genome Institute

Washington University

Transcript

lnc-RNF135-1:14

Chromosome

chr17

Gene Name

lnc-RNF135-1

Start

31008753

CPC Label

noncoding

End

31031946

Cancer

BRCA-Luminal B

Strand

+

Peptide

QGAGFLR

Modified Peptide

n[145]QGAGFLR

Peptide Length

7

ORF Length

135

Open Reading Frame (ORF)

LHLTDVSLTSGNLIAFGLPDPFAKVVVDGSGQCHSIDTVKNMLDPKWNQHYDLYIEKSDSVTISVWNHKKIHKKQGAGFLRCVHLFPVPSTTSKTLVIRGWIYANLGQRTVRRRKSSVQRPNWYRKTSYGLQSFI

Conservation Score

1

PhyloCSF Frame 1

6.244

No. of Spectra

14

CPC Coding Probability

0.0578729

PhyloCSF Frame 2 

7.817

CNTI Index

noncoding

Max Probability

0.933

PhyloCSF Frame 3

9.919

CNTI Score

-0.351166571