McDonnell Genome Institute

Washington University

Transcript

lnc-RNF13-5:1

Chromosome

chr3

Gene Name

lnc-RNF13-5

Start

150050728

CPC Label

noncoding

End

150051456

Cancer

CCRC

Strand

+

Peptide

ETFGVNSTVYGIDAMNPSSR

Modified Peptide

n[230]ETFGVNSTVYGIDAMNPSSR

Peptide Length

20

ORF Length

129

Open Reading Frame (ORF)

LGLNKLQEESDLELAKETFGVNSTVYGIDAMNPSSRDDFTEFGKLLKDKITQNEKSLYDVFFFLEILVRDVCISLEIDNLKKITNSLTVLCRKNRSKKNQKEEERCGSWRGIKATMKDDLADYGGYDGG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0596737

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9955

PhyloCSF Frame 3

0

CNTI Score

0.633331243